PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_013621359.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family G2-like
Protein Properties Length: 371aa    MW: 40801.4 Da    PI: 8.2248
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_013621359.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like101.55.3e-32221276156
         G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRla 56 
                     k+r++W+peLH+rF++a++qLGGs++AtPk+i+++mkv+gLt+++vkSHLQkYRl+
  XP_013621359.1 221 KQRRCWSPELHRRFLHALQQLGGSHVATPKQIRDHMKVDGLTNDEVKSHLQKYRLH 276
                     79****************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129415.038218278IPR017930Myb domain
SuperFamilySSF466891.08E-17218279IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.607.1E-28219279IPR009057Homeodomain-like
TIGRFAMsTIGR015571.4E-26221276IPR006447Myb domain, plants
PfamPF002496.0E-8223274IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009737Biological Processresponse to abscisic acid
GO:0055062Biological Processphosphate ion homeostasis
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 371 aa     Download sequence    Send to blast
MENDYAQKMQ RCHEYVEALE EEQKKIQVFQ RELPLCLELV TQAIEACRKE LPSTSTTSEQ  60
CSEQTTSVSG GPVLEEFIPT KKIEENGEHE SPTPEEIGNN VDKKKSDWLR SVQLWNSSPD  120
TNEVSNPERV VGKKAKVVEV KPNNNNNCGG FQPFQREKKR VFSETDLQPA AVKAVASAPA  180
VKVVASAPAT TTSSTTETCG VGKGGEEHLH QQQSQSQTRR KQRRCWSPEL HRRFLHALQQ  240
LGGSHVATPK QIRDHMKVDG LTNDEVKSHL QKYRLHTRRP ATTVTAQGNG NSQQQQFMVV  300
GGIWVPSPQD VPPPSDVANN GGGAYAPVTL QPPPQPLPLQ SPKRSVERSS GRCNSQAASS  360
STNTTTSSPV S
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00218DAPTransfer from AT1G68670Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013621359.10.0PREDICTED: uncharacterized protein LOC106327680
TrEMBLA0A0D3AP120.0A0A0D3AP12_BRAOL; Uncharacterized protein
STRINGBra038360.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM34912863
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G68670.11e-102G2-like family protein